How can i compute Amino Acid composition for my protein sequence data?
2 Ansichten (letzte 30 Tage)
Ältere Kommentare anzeigen
Nedz
am 23 Apr. 2020
Beantwortet: Tim DeFreitas
am 23 Apr. 2020
How can i get/compute the amino composition for my protein sequences inorder to further use it to train my SVM classifier?
for example if, i have the following sequence as one of my sequence sample:
'AEYDDSLIDEEEDDEDLDEFKPIVQYDNFQDEENIGIYKELEDLIEKNE'
0 Kommentare
Akzeptierte Antwort
Tommy
am 23 Apr. 2020
Bearbeitet: Tommy
am 23 Apr. 2020
allAA = sort('ARNDCQEGHILKMFPSTWYV');
seq = 'AEYDDSLIDEEEDDEDLDEFKPIVQYDNFQDEENIGIYKELEDLIEKNE';
counts = histc(seq, allAA);
freq = counts/numel(seq);
for aa = allAA
fprintf('%c: %d/%d (%.4f%%)\n', aa, counts(allAA==aa), numel(seq), freq(allAA==aa));
end
%{
prints:
A: 1/49 (0.0204%)
C: 0/49 (0.0000%)
D: 10/49 (0.2041%)
E: 12/49 (0.2449%)
F: 2/49 (0.0408%)
G: 1/49 (0.0204%)
H: 0/49 (0.0000%)
I: 5/49 (0.1020%)
K: 3/49 (0.0612%)
L: 4/49 (0.0816%)
M: 0/49 (0.0000%)
N: 3/49 (0.0612%)
P: 1/49 (0.0204%)
Q: 2/49 (0.0408%)
R: 0/49 (0.0000%)
S: 1/49 (0.0204%)
T: 0/49 (0.0000%)
V: 1/49 (0.0204%)
W: 0/49 (0.0000%)
Y: 3/49 (0.0612%)
%}
0 Kommentare
Weitere Antworten (1)
Tim DeFreitas
am 23 Apr. 2020
If you have the Bioinformatics Toolbox, there's also the AACOUNT function:https://www.mathworks.com/help/bioinfo/ref/aacount.html
seq = 'AEYDDSLIDEEEDDEDLDEFKPIVQYDNFQDEENIGIYKELEDLIEKNE';
counts = aacount(seq)
% Optional: plotting included
aacount(seq, 'chart', 'bar')
0 Kommentare
Siehe auch
Kategorien
Mehr zu Biological and Health Sciences finden Sie in Help Center und File Exchange
Community Treasure Hunt
Find the treasures in MATLAB Central and discover how the community can help you!
Start Hunting!